PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_007725
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family TALE
Protein Properties Length: 588aa    MW: 65065.7 Da    PI: 6.8237
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_007725genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox253.1e-085065441854
                  HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  +F++  ++yp+ +++  LA k gLt +qV++WF N R +
  DCAR_007725 506 MFQNflHPYPKDADKHLLAVKSGLTRSQVSNWFINARVR 544
                  5887779******************************88 PP

2BELL73.82.9e-24379446371
         BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                  qe  +kk +L++lle+Vd+rY+q  ++++ vis+F+av++l++ +++++lAl++iS  +++L+++i++ 
  DCAR_007725 379 QEAAAKKKHLINLLEMVDNRYNQSLDEIHKVISAFHAVTELDP-QIHARLALQTISLLYQSLRERISNY 446
                  78899**************************************.**********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.3E-16306445IPR006563POX domain
PfamPF075262.1E-22312444IPR006563POX domain
PROSITE profilePS5007110.867485548IPR001356Homeobox domain
CDDcd000865.59E-11488549No hitNo description
SMARTSM003892.7E-5488552IPR001356Homeobox domain
SuperFamilySSF466895.56E-15490557IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-25491554IPR009057Homeodomain-like
PfamPF059205.5E-15505544IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MDNDIFGVPA DTVYQNPVAG SGNVLSSTLF SFLQSHPHDL TNQNQIMAGF PALSVMQVET  60
PDELHDVHQL TSHAGFDTSN ALVLKGPQPG RNVTGNTSIC PPGSPSNKEA DVRFMAGMHN  120
STTSLATLLA GRYGNHRNLN DIERLGYSGH HREVPEILGS NEYADLVQSS YGTSMDYNND  180
VMLGNVSCKW GSHKFAAPQS AGTVPQRIGL EAYQNMGNMD HNGWTSSENN IGSDNTSDSS  240
KYSNGLSLSL LTSQPATLGG TTIVEHCSGM SASGLSCQSL HGKQLGIEQT SFNSKNMSST  300
FGKNPVQLSD FLSGGRFLSE MQEILAGIAR YSLGNSGRSS CPTSAPVPEE NFSFSFNLST  360
GRQKTVTGTI GNDLMTCEQE AAAKKKHLIN LLEMVDNRYN QSLDEIHKVI SAFHAVTELD  420
PQIHARLALQ TISLLYQSLR ERISNYILSL GVHVNEGGSE EEERSFETSF IQKQWALQQL  480
RQKDHQLWRP QRGLPERSVS VLRAWMFQNF LHPYPKDADK HLLAVKSGLT RSQVSNWFIN  540
ARVRLWKPMI DEMYSEMNRR KICQNGDEIN SQHKNRFNID SQRFRMI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B3e-15494551158Homeobox protein Meis1
4xrs_A3e-15494551158Homeobox protein Meis1
5bng_A4e-15494552159Homeobox protein Meis2
5bng_B4e-15494552159Homeobox protein Meis2
3k2a_B5e-15494552563Homeobox protein Meis2
3k2a_A5e-15494552563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278796.31e-166PREDICTED: homeobox protein ATH1
RefseqXP_010648330.11e-166PREDICTED: homeobox protein ATH1
RefseqXP_010648331.11e-166PREDICTED: homeobox protein ATH1
RefseqXP_010648332.11e-166PREDICTED: homeobox protein ATH1
SwissprotP487316e-93ATH1_ARATH; Homeobox protein ATH1
TrEMBLF6H3951e-167F6H395_VITVI; Putative uncharacterized protein
STRINGVIT_04s0008g00880.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.14e-90homeobox gene 1